PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo7G0012500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 243aa    MW: 26370.5 Da    PI: 5.1894
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo7G0012500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.4e-131661146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde l+++vk++G+++W++I ++  + R++k+c++rw +
   Spipo7G0012500 16 KGPWMAEEDEVLIEYVKKYGPRDWSSIRSKGLLPRSGKSCRLRWVN 61
                     79*************************8876677**********87 PP

2Myb_DNA-binding45.91.3e-1472112345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++++eE+ + +++ +q+G++ W++Ia +++ gRt++++k++w 
   Spipo7G0012500  72 KFSAEEERIVIELQAQFGNK-WARIATYLP-GRTDNDVKNFWS 112
                      79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3391163IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-201264IPR009057Homeodomain-like
SuperFamilySSF466892.13E-2813111IPR009057Homeodomain-like
SMARTSM007171.2E-111565IPR001005SANT/Myb domain
PfamPF002499.9E-121661IPR001005SANT/Myb domain
CDDcd001671.01E-121863No hitNo description
PROSITE profilePS5129420.91164119IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-1965117IPR009057Homeodomain-like
SMARTSM007174.6E-1369117IPR001005SANT/Myb domain
CDDcd001677.67E-1272111No hitNo description
PfamPF002496.0E-1372112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MRRRDGGSTS AAPLRKGPWM AEEDEVLIEY VKKYGPRDWS SIRSKGLLPR SGKSCRLRWV  60
NKLKPDLKTG CKFSAEEERI VIELQAQFGN KWARIATYLP GRTDNDVKNF WSTRQKRLAR  120
LLQAQSGPNS EDLHGRCSLH HEQRIAFEAL LDLPLLPETH HLATDFEGVD FDPESLAHDV  180
PDFDLFSDGL AAPPPGGSGG GGGGGGGGEF DEGMPAAADG LFGDFPVEML DGLDPPASSS  240
PS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-291411725126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010259182.12e-73PREDICTED: myb-related protein 305-like
TrEMBLK9LXH92e-71K9LXH9_9ASPA; R2R3 MYB DUO1-like protein
STRINGSi015815m8e-67(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.13e-66MYB family protein